Antibodies

View as table Download

Rabbit Polyclonal Anti-APOBEC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOBEC1 antibody: synthetic peptide directed towards the N terminal of human APOBEC1. Synthetic peptide located within the following region: TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW

Goat Anti-APOBEC1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence DVFYDPRELRKEAC, from the internal region (near N Terminus) of the protein sequence according to NP_001635.2.

APOBEC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human APOBEC1

APOBEC1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated