Rabbit Polyclonal Anti-APOBEC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOBEC2 antibody: synthetic peptide directed towards the N terminal of human APOBEC2. Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN |
Rabbit Polyclonal Anti-APOBEC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOBEC2 antibody: synthetic peptide directed towards the middle region of human APOBEC2. Synthetic peptide located within the following region: CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL |
APOBEC2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human APOBEC2 |
Goat Polyclonal Antibody against APOBEC2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EAASQNGEDLENLDD, from the internal region (near the N Terminus) of the protein sequence according to NP_006780.1. |
Goat Polyclonal Antibody against APOBEC2 (Internal Region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KPQDFEYVWQN, from the internal region of the protein sequence according to NP_006780.1. |
Rabbit Polyclonal Anti-APOBEC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human APOBEC2 |
APOBEC2 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse APOBEC2 |
APOBEC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human APOBEC2. |
Germany
Japan
United Kingdom
China
