Germany
Japan
United Kingdom
China
Antibodies
View as table Download
APOBEC3G Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
APOBEC3G (C-term) goat polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide from the C-Terminus of Human APOBEC3G (NP_068594.1). Percent identity by BLAST analysis: Human, Baboon (100%); Monkey (92%); Chimpanzee, Gorilla, Gibbon, Marmoset (83%). |
Rabbit Polyclonal APOBEC3G Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | APOBEC3G antibody was raised against a synthetic peptide corresponding to 15 amino acids near the amino-terminus of human APOBEC3G APOBEC3G antibody will also detect the APOBEC3F isoform. |
Rabbit Polyclonal Anti-APOBEC3G Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APOBEC3G Antibody: synthetic peptide directed towards the N terminal of human APOBEC3G. Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC |
Goat Anti-APOBEC3G / ARP9 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKWRKLHRDQE, from the internal region of the protein sequence according to NP_068594.1 |
Rabbit Polyclonal Anti-APOBEC3G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APOBEC3G Antibody: synthetic peptide directed towards the N terminal of human APOBEC3G. Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC |
APOBEC3G Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- APOBEC3G