Rabbit Polyclonal Anti-Apof Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Apof antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSG |
Rabbit polyclonal anti-APOF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APOF. |
Rabbit polyclonal APOF Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APOF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 111-138 amino acids from the Central region of human APOF. |
Goat Anti-Apolipoprotein F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KSYDLDPGAGSLE, from the C Terminus of the protein sequence according to NP_001629.1. |
APOF Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human APOF |
APOF Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human APOF (NP_001629.1). |
| Modifications | Unmodified |
APOF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic Peptide of human APOF |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
