Antibodies

View as table Download

Rabbit Polyclonal Anti-FAM121B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the C terminal of human FAM121B. Synthetic peptide located within the following region: LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Rabbit Polyclonal Anti-FAM121B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the N terminal of human FAM121B. Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL