Antibodies

View as table Download

Rabbit anti-APTX Polyclonal Antibody

Applications ELISA, ICC/IF, IP, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-APTX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APTX antibody: synthetic peptide directed towards the C terminal of human APTX. Synthetic peptide located within the following region: VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ

Rabbit Polyclonal Anti-APTX Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-APTX Antibody: synthetic peptide directed towards the middle region of human APTX. Synthetic peptide located within the following region: YPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSN

Rabbit Polyclonal Anti-APTX Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-APTX Antibody: synthetic peptide directed towards the N terminal of human APTX. Synthetic peptide located within the following region: MMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQLKAE

Rabbit Polyclonal Anti-APTX Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human APTX

APTX rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human APTX