Germany
Japan
United Kingdom
China
Rabbit anti-AREG Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AREG |
Antibodies
View as table Download
Rabbit Polyclonal Anti-AREG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AREG |
Rabbit Polyclonal anti-AREG antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AREG antibody: synthetic peptide directed towards the middle region of human AREG. Synthetic peptide located within the following region: PQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR |
AREG Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-252 of human AREG (NP_001648.1). |
| Modifications | Unmodified |
Amphiregulin Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Produced from sera of rabbits immunized with highly pure Recombinant Human Amphiregulin. Anti-Human Amphiregulin-specific antibody was purified by affinity chromatography employing an immobilized Human Amphiregulin matrix. |
Amphiregulin Antibody (biotin)
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Produced from sera of rabbits immunized with highly pure Recombinant Human Amphiregulin. Anti-Human Amphiregulin-specific antibody was purified by affinity chromatography and then biotinylated. |
Active filters
Target Symbol
- AREG