Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-ARF6 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ARF6 |
Rabbit polyclonal anti-ARF6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ARF6. |
Rabbit Polyclonal Anti-ARF6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARF6 antibody: synthetic peptide directed towards the middle region of human ARF6. Synthetic peptide located within the following region: REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG |
Anti-ARF6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 162-175 amino acids of Human ADP-ribosylation factor 6 |
ARF6 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human ARF6 (NP_001654.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ARF6