Antibodies

Jump to Filters
View as table Download
ARFIP1 (Center) Rabbit Polyclonal Antibody
AP50226PU-N

USD 450.00

2 Weeks

ARFIP1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 114-144 amino acids from the Central region of human ARFIP1
ARFIP1 Rabbit Polyclonal Antibody
TA315373

USD 345.00

4 Weeks

Rabbit polyclonal anti-ARFIP1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARFIP1.
ARFIP1 Rabbit Polyclonal Antibody
TA334957

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARFIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARFIP1 antibody: synthetic peptide directed towards the C terminal of human ARFIP1. Synthetic peptide located within the following region: NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL
ARFIP1 Rabbit Polyclonal Antibody
TA359284

USD 360.00

5 Days

ARFIP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human ARFIP1