Rabbit polyclonal ARGFX Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARGFX antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 103-132 amino acids from the Central region of human ARGFX. |
Rabbit Polyclonal Anti-ARGFX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARGFX antibody: synthetic peptide directed towards the N terminal of human ARGFX. Synthetic peptide located within the following region: TTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPEST |
Rabbit Polyclonal Anti-ARGFX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARGFX antibody: synthetic peptide directed towards the N terminal of human ARGFX. Synthetic peptide located within the following region: MFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILP |
Germany
Japan
United Kingdom
China
