Antibodies

Jump to Filters
View as table Download
ARHGAP11B Rabbit Polyclonal Antibody
TA334130

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARHGAP11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARHGAP11B Antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP11B. Synthetic peptide located within the following region: MDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMV
ARHGAP11B Rabbit Polyclonal Antibody
TA373649

USD 220.00

3 Weeks

ARHGAP11B Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 218-267 of human ARHGAP11B (NP_001034930.1).
Modifications Unmodified