Antibodies

View as table Download

Rabbit Polyclonal Anti-ARHGAP11B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARHGAP11B Antibody is: synthetic peptide directed towards the C-terminal region of Human ARHGAP11B. Synthetic peptide located within the following region: MDSSNLAVIFAPNLLQTSEGHEKMSSNAEKKGVYQTLSWKRYQPCWVLMV

ARHGAP11B Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Modifications Unmodified