Rabbit Polyclonal Anti-ARHGAP15 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARHGAP15 antibody: synthetic peptide directed towards the middle region of human ARHGAP15. Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ |
Rabbit Polyclonal Anti-ARHGAP15 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARHGAP15 antibody: synthetic peptide directed towards the middle region of human ARHGAP15. Synthetic peptide located within the following region: LLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPS |
Rabbit Polyclonal Anti-ARHGAP15 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARHGAP15 |
ARHGAP15 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARHGAP15 |
Germany
Japan
United Kingdom
China
