Rabbit Polyclonal Anti-ARID3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARID3B Antibody: synthetic peptide directed towards the N terminal of human ARID3B. Synthetic peptide located within the following region: DPRVAPMSNLLPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDE |
Rabbit Polyclonal Anti-ARID3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARID3B Antibody: synthetic peptide directed towards the C terminal of human ARID3B. Synthetic peptide located within the following region: ERLESGEPAEKKASRLSEEEQRLVQQAFQRNFFSMARQLPMKIRINGRED |
Rabbit Polyclonal Anti-ARID3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARID3B antibody: synthetic peptide directed towards the N terminal of human ARID3B. Synthetic peptide located within the following region: MEPLQQQQQQQQQQQKQPHLAPLQMDAREKQGQQMREAQFLYAQKLVTQP |
Rabbit Polyclonal Anti-ARID3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARID3B antibody: synthetic peptide directed towards the C terminal of human ARID3B. Synthetic peptide located within the following region: AQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWSL |
Germany
Japan
United Kingdom
China