Antibodies

Jump to Filters
View as table Download
ARL9 Rabbit Polyclonal Antibody
TA343237

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARL9 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Arl9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Arl9. Synthetic peptide located within the following region: EMYLPKGWLLIFVVDSADHKRLPEAKKYLHQLINPNPGLPLVVFANKQVF