Rabbit Polyclonal Anti-ARMC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARMC1 antibody is: synthetic peptide directed towards the C-terminal region of Human ARMC1. Synthetic peptide located within the following region: VEQNTELPDYLPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSF |
USD 420.00
5 Days
ARMC1 mouse monoclonal antibody,clone OTI2B12
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
5 Days
ARMC1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARMC1 mouse monoclonal antibody,clone OTI2E5
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ARMC1 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
