Rabbit Polyclonal Anti-ARNT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ARNT2 antibody is: synthetic peptide directed towards the N-terminal region of Human ARNT2. Synthetic peptide located within the following region: VTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHS |
ARNT2 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal ARNT2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ARNT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 249-278 amino acids from the Central region of human ARNT2. |
Rabbit polyclonal anti-ARNT2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARNT2. |
DKFZp686M216 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human DKFZp686M216 |
ARNT2 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
