Antibodies

View as table Download

Rabbit Polyclonal antibody to ARPC2 (actin related protein 2/3 complex, subunit 2, 34kDa)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 14 and 300 of ARPC2 (Uniprot ID#O15144)

Rabbit Polyclonal Anti-ARPC2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARPC2 antibody: synthetic peptide directed towards the N terminal of human ARPC2. Synthetic peptide located within the following region: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL

Goat Polyclonal Antibody against ARPC2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EMKTITGKTFSSR, from the C Terminus of the protein sequence according to NP_005722; NP_690601.

Rabbit Polyclonal Anti-ARPC2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARPC2

ARPC2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ARPC2

ARPC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARPC2

ARPC2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ARPC2 (NP_690601.1).
Modifications Unmodified

ARPC2 Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated