Antibodies

Jump to Filters
View as table Download
Arpc5 Rabbit Polyclonal Antibody
TA337971

USD 375.00

5 Days

Rabbit Polyclonal Anti-Arpc5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Arpc5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Arpc5. Synthetic peptide located within the following region: VDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN
p16 ARC (ARPC5) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
CF505696

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) ARPC5 mouse monoclonal antibody,clone OTI2G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p16 ARC (ARPC5) Rabbit Polyclonal Antibody
TA373696

USD 410.00

3 Weeks

p16-ARC/ARC16/ARPC5 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified
p16 ARC (ARPC5) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
TA505696

USD 447.00

In Stock

ARPC5 mouse monoclonal antibody,clone OTI2G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
p16 ARC (ARPC5) Mouse Monoclonal Antibody [Clone ID: OTI2G1]
TA505696S

USD 200.00

In Stock

ARPC5 mouse monoclonal antibody,clone OTI2G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated