Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit Polyclonal beta-Arrestin 2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Goat Polyclonal Antibody against ARRB2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HDHIPLPRPQS, from the internal region of the protein sequence according to NP_004304.1; NP_945355.1. |
ARRB2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ARRB2 |
ARRB2 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
