Antibodies

Jump to Filters
View as table Download
ARV1 (N-term) Rabbit Polyclonal Antibody
AP50263PU-N

USD 450.00

2 Weeks

ARV1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Mouse
Immunogen KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of human ARV1.
ARV1 Rabbit Polyclonal Antibody
TA338620

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARV1 antibody: synthetic peptide directed towards the middle region of human ARV1. Synthetic peptide located within the following region: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD