Antibodies

View as table Download

Rabbit Polyclonal Anti-ASCL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASCL1 antibody: synthetic peptide directed towards the N terminal of human ASCL1. Synthetic peptide located within the following region: QSAQQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELM

ASCL1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 140-190 of Human ASCL1.

Rabbit polyclonal ASCL1 Antibody(N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ASCL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-90 amino acids from the N-terminal region of human ASCL1.

Rabbit Polyclonal anti-ASCL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ASCL1 antibody is: synthetic peptide directed towards the N-terminal region of Human ASCL1. Synthetic peptide located within the following region: AQQQQQQQQQQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRC

Rabbit Polyclonal Anti-ASCL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASCL1 antibody: synthetic peptide directed towards the middle region of human ASCL1. Synthetic peptide located within the following region: AGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNW

Anti-ASCL1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-228 amino acids of human achaete-scute complex homolog 1 (Drosophila)

ASCL1 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human ASCL1

ASCL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ASCL1

AscL1 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified