Antibodies

Jump to Filters
View as table Download
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA332763

USD 410.00

3 Weeks

Rabbit anti-ASNS Polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA342876

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASNS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR
Asparagine synthetase (ASNS) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF503444

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ASNS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA349668

USD 345.00

In Stock

Rabbit Polyclonal Anti-ASNS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASNS
ASNS Rabbit Polyclonal Antibody
TA368987

USD 380.00

4 Weeks

ASNS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASNS
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA373747

USD 410.00

3 Weeks

ASNS Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified
Asparagine synthetase (ASNS) Rabbit Polyclonal Antibody
TA383754

USD 380.00

4 Weeks

Asparagine Synthetase Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ASNS
Asparagine synthetase (ASNS) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA503444

USD 447.00

In Stock

ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Asparagine synthetase (ASNS) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
TA503444S

USD 159.00

In Stock

ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Asparagine synthetase (ASNS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A10]
TA503452AM

USD 420.00

4 Weeks

ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1A10 (formerly 1A10), Biotinylated

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Asparagine synthetase (ASNS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]
TA503452BM

USD 420.00

4 Weeks

ASNS (Asparagine synthetase) mouse monoclonal antibody, clone OTI1A10 (formerly 1A10), HRP conjugated

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP