Rabbit Polyclonal Anti-Asprv1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Asprv1 antibody is: synthetic peptide directed towards the middle region of Mouse Asprv1. Synthetic peptide located within the following region: DVLQDHNAVLDFEHRTCTLKGKKFRLLPVGSSLEDEFDLELIEEEEESSA |
Rabbit Polyclonal Anti-ASPRV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASPRV1antibody: synthetic peptide directed towards the middle region of human SASP. Synthetic peptide located within the following region: RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM |
Germany
Japan
United Kingdom
China