Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against ASRGL1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EKHEKGAQKTDCQ, from the internal region of the protein sequence according to NP_001077395.1; NP_079356.3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Asrgl1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Asrgl1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALFHVEQGKTVEEAAQLALDYMKSKLKGLGGLILVNKTGDWVAKWTSASM |
ASRGL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ASGL1 |
ASRGL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ASRGL1 |
Active filters
Target Symbol
- ASRGL1