Antibodies

Jump to Filters
View as table Download
ASTN2 Rabbit Polyclonal Antibody
TA341927

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASTN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASTN2 antibody: synthetic peptide directed towards the N terminal of human ASTN2. Synthetic peptide located within the following region: LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENG
ASTN2 Rabbit Polyclonal Antibody
TA366276

USD 380.00

4 Weeks

ASTN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ASTN2
ASTN2 Rabbit Polyclonal Antibody
TA370626

USD 380.00

4 Weeks

ASTN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ASTN2