Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ATF3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF3. |
Antibodies
View as table Download
Rabbit Monoclonal antibody against ATF-3 (ATF3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-ATF3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF3 |
ATF3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 139-168 amino acids from the C-terminal region of human ATF3 |
Rabbit Polyclonal anti-Atf3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Atf3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Atf3. Synthetic peptide located within the following region: ESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFI |
Rabbit Polyclonal Anti-ATF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF3 antibody: synthetic peptide directed towards the middle region of human ATF3. Synthetic peptide located within the following region: PLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK |
Carrier-free (BSA/glycerol-free) ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ATF3 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATF3 |
ATF3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ATF3 (NP_001665.1). |
| Modifications | Unmodified |
ATF3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ATF3 (NP_001665.1). |
| Modifications | Unmodified |
ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ATF3 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ATF3