Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ATF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4 |
Rabbit Polyclonal Anti-Atf4 Antibody
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR |
Goat Polyclonal Antibody against ATF4
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEVRKARGKKRVP, from the C Terminus of the protein sequence according to NP_001666. |
Rabbit polyclonal ATF-4 (Phospho-Ser219) antibody
| Applications | WB |
| Reactivities | H:S219, M:S218 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATF-4. |
| Modifications | Phospho-specific |
Rabbit anti-ATF4 (Phospho-Ser245) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanATF4 around the phosphorylation site of serine 245 (N-R-SP-L-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal ATF4 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the Middle Region |
Rabbit polyclonal ATF4(Ab-245) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human ATF4 around the phosphorylation site of Serine 245. |
Rabbit polyclonal ATF-4 (Ab-219) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ATF4. |
Rabbit Polyclonal Anti-ATF4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the N terminal of mouse ATF4. Synthetic peptide located within the following region: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPEQRSVGGGLDD |
Rabbit polyclonal ATF4 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ATF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 171-198 amino acids from the Central region of human ATF4. |
Rabbit Polyclonal Anti-ATF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the middle region of human ATF4. Synthetic peptide located within the following region: LGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGS |
Rabbit Polyclonal Anti-ATF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the C terminal of human ATF4. Synthetic peptide located within the following region: EQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLK |
Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI1H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI5F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATF4 mouse monoclonal antibody, clone OTI8F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ATF4 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of mouse ATF4 |
ATF4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4. |
| Modifications | Unmodified |
ATF4 mouse monoclonal antibody, clone OTI1H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
ATF4 mouse monoclonal antibody, clone OTI1H9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
2 Weeks
ATF4 mouse monoclonal antibody, clone OTI1H9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ATF4 mouse monoclonal antibody, clone OTI1H9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ATF4 mouse monoclonal antibody, clone OTI5F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
ATF4 mouse monoclonal antibody, clone OTI5F5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
2 Weeks
ATF4 mouse monoclonal antibody, clone OTI5F5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ATF4 mouse monoclonal antibody, clone OTI5F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ATF4 mouse monoclonal antibody, clone OTI8F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
ATF4 mouse monoclonal antibody, clone OTI8F5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
2 Weeks
ATF4 mouse monoclonal antibody, clone OTI8F5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ATF4 mouse monoclonal antibody, clone OTI8F5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ATF4