Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal ATF6 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ATF6 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ATF6. The immunogen is located within amino acids 30 - 80 of ATF6. |
ATF6 mouse monoclonal antibody, clone 3D5, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
ATF6 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Rabbit |
| Immunogen | Synthetic peptide from C-terminus of human ATF6 |
Rabbit Polyclonal Anti-Atf6 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atf6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST |
Rabbit Polyclonal anti-ATF6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF6 antibody: synthetic peptide directed towards the N terminal of human ATF6. Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD |
ATF6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATF6 |
Active filters
Target Symbol
- ATF6