Antibodies

View as table Download

Mouse Monoclonal ATF6 Antibody (70B1413.1)

Applications FC, IHC, WB
Reactivities Fish, Hamster, Human, Mouse, Rabbit, Rat

Rabbit Polyclonal ATF6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ATF6 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human ATF6.

Rabbit Polyclonal ATF6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ATF6 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ATF6. The immunogen is located within amino acids 30 - 80 of ATF6.

ATF6 mouse monoclonal antibody, clone 3D5, Purified

Applications ELISA, IHC, WB
Reactivities Human

ATF6 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human, Rabbit
Immunogen Synthetic peptide from C-terminus of human ATF6

ATF6 Rabbit Polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ATF6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 356~386 amino acids from the Center region of Human ATF6.

Rabbit Polyclonal Anti-Atf6 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Atf6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST

Rabbit Polyclonal ATF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human ATF6 protein (within residues 200-350). [Swiss-Prot P18850]

Rabbit Polyclonal anti-ATF6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF6 antibody: synthetic peptide directed towards the N terminal of human ATF6. Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD

Rabbit Polyclonal Anti-ATF6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATF6

ATF6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATF6