Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal ATG10 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ATG10 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human ATG10. |
Rabbit Polyclonal Anti-ATG10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG10 Antibody: synthetic peptide directed towards the C terminal of human ATG10. Synthetic peptide located within the following region: TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP |
ATG10 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATG10 |
ATG10 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
ATG10 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Apg10 (Atg10) |
Active filters
Target Symbol
- ATG10