Rabbit Polyclonal Anti-ATG4D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ATG4D antibody was raised against a 17 amino acid peptide near the amino terminus of human ATG4D. |
Rabbit Polyclonal Anti-ATG4D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ATG4D antibody was raised against a 17 amino acid peptide near the amino terminus of human ATG4D. |
Rabbit polyclonal anti-ATG4C antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATG4C. |
Rabbit Polyclonal Anti-ATG4C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4C antibody: synthetic peptide directed towards the middle region of human ATG4C. Synthetic peptide located within the following region: TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS |
Goat Polyclonal Anti-ATG4C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C- terminus of NP_116241.2; NP_835739.1 (EDEKKQLKRFSTEE) |
Rabbit Polyclonal Anti-ATG4C Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATG4C |
ATG4C rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATG4C |
ATG4C Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
ATG4C Rabbit polyclonal Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Atg4C |
ATG4C Rabbit monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |