Germany
Japan
United Kingdom
China
Rabbit anti-ATP1B1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
USD 424.00
In Stock
Goat Anti-ATP1B1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KTEISFRPNDPKSYE, from the internal region of the protein sequence according to NP_001668.1; NP_001001787.1. |
Rabbit Polyclonal Anti-ATP1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the N terminal of human ATP1B1. Synthetic peptide located within the following region: RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD |
Rabbit Polyclonal Anti-ATP1B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL |
ATP1B1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 65-240 of human ATP1B1 (NP_001668.1). |
| Modifications | Unmodified |
USD 380.00
4 Weeks
Active filters
Target Symbol
- ATP1B1