Antibodies

Jump to Filters
View as table Download
SERCA3 (ATP2A3) Rabbit Polyclonal Antibody
TA339001

USD 375.00

5 Days

Rabbit Polyclonal Anti-ATP2A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS
SERCA3 (ATP2A3) Rabbit Polyclonal Antibody
TA351651

USD 345.00

In Stock

Rabbit Polyclonal Anti-ATP2A3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATP2A3
ATP2A3 Rabbit Polyclonal Antibody
TA367245

USD 380.00

4 Weeks

ATP2A3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATP2A3
SERCA3 (ATP2A3) Rabbit Polyclonal Antibody
TA373814

USD 220.00

3 Weeks

ATP2A3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-600 of human ATP2A3 (NP_005164.2).
Modifications Unmodified