Rabbit Polyclonal Anti-ATP2B3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2B3 antibody: synthetic peptide directed towards the N terminal of human ATP2B3. Synthetic peptide located within the following region: GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE |
Rabbit Polyclonal Anti-ATP2B3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2B3 antibody: synthetic peptide directed towards the N terminal of human ATP2B3. Synthetic peptide located within the following region: AEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQ |
Germany
Japan
United Kingdom
China