Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ATP6V1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V1A antibody: synthetic peptide directed towards the N terminal of human ATP6V1A. Synthetic peptide located within the following region: SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR |
ATP6V1A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2). |
| Modifications | Unmodified |
ATP6V1A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ATP6V1A (NP_001681.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ATP6V1A