Antibodies

Jump to Filters
View as table Download
ATP6V1G2 Rabbit Polyclonal Antibody
TA344635

USD 475.00

5 Days

Rabbit Polyclonal Anti-ATP6V1G2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V1G2 antibody: synthetic peptide directed towards the middle region of human ATP6V1G2. Synthetic peptide located within the following region: NLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRIS
ATP6V1G2 Rabbit Polyclonal Antibody
TA373846

USD 220.00

3 Weeks

ATP6V1G2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ATP6V1G2.
Modifications Unmodified