Germany
Japan
United Kingdom
China
Antibodies
View as table Download
AURKA Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AURKA |
Mouse Monoclonal Aurora A Antibody (1F8)
| Applications | ELISA, FC, WB |
| Reactivities | Human, Rat, Primate |
| Conjugation | Unconjugated |
TA336917 is a replacement of AM06572SU-N.
Rabbit Polyclonal Aurora Kinase (Thr288) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Aurora Kinase around the phosphorylation site of Threonine 288 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-AurA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AurA Antibody: A synthesized peptide derived from human AurA |
USD 465.00
2 Weeks
Aurora A (AURKA) (C-term) (incl. pos. control) mouse monoclonal antibody, clone 5F11, Purified
| Applications | FC, IF, WB |
| Reactivities | Human |
USD 440.00
2 Weeks
Rabbit Polyclonal Aurora Kinase Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Aurora Kinase |
Phospho-AURKA-T288 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T288 of human AURKA |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-AURKA antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AURKA antibody: synthetic peptide directed towards the C terminal of human AURKA. Synthetic peptide located within the following region: ARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS |
Rabbit Polyclonal Anti-AURKA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AURKA Antibody is: synthetic peptide directed towards the middle region of Human AURKA. Synthetic peptide located within the following region: REKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF |
USD 465.00
2 Weeks
Aurora A (AURKA) (N-term) (incl. pos. control) mouse monoclonal antibody, clone 7F12, Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
Aurora Kinase 2 Mouse Monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
AURKA rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AURKA |
AURKA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human AURKA (NP_940837.1). |
| Modifications | Unmodified |
Phospho-AURKA-T288 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around T288 of human AURKA (NP_003591.2). |
| Modifications | Phospho T288 |
AURKA/AURKB/AURKC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250 to 350 of human AURKA/AURKB/AURKC (NP_003591.2). |
| Modifications | Unmodified |
Phospho-AURKA-T288/AURKB-T232/AURKC-T198 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T288/T232/T198 of human AURKA/AURKB/AURKC. |
| Modifications | Phospho T288,Phospho T232,Phospho T198 |
Active filters
Target Symbol
- AURKA