Rabbit polyclonal AurB/C (Ab-202/175) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AurB/C around the phosphorylation site of threonine 202/175 (C-G-TP-L-D). |
Goat Anti-AURKC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PRAVVQLGKAQP-C, from the N Terminus of the protein sequence according to NP_001015878.1. |
Rabbit polyclonal Aurora-C Antibody (N-term M1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C. |
Rabbit polyclonal Aurora-C Antibody (N-term G11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Aurora-C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Aurora-C. |
Rabbit Polyclonal Anti-AURKC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AURKC Antibody: synthetic peptide directed towards the middle region of human AURKC. Synthetic peptide located within the following region: TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL |
AURKC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AURKC (NP_001015878.1). |
AURKC Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AURKC |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
Anti-AURKC mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
5 Days
USD 420.00
5 Days
Anti-AURKC mouse monoclonal antibody, clone OTI10A7 (formerly 10A7)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Anti-AURKC mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
