Rabbit Polyclonal Anti-AVIL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AVIL antibody: synthetic peptide directed towards the middle region of human AVIL. Synthetic peptide located within the following region: QELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF |
Rabbit Polyclonal Anti-AVIL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AVIL antibody: synthetic peptide directed towards the middle region of human AVIL. Synthetic peptide located within the following region: PKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALP |
Avil Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
AVIL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 470-819 of human AVIL (NP_006567.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China