Antibodies

Jump to Filters
View as table Download
AVPR V2 (AVPR2) Rabbit Polyclonal Antibody
TA313495

USD 345.00

4 Weeks

Rabbit polyclonal anti-AVPR2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AVPR2.
AVPR V2 (AVPR2) Rabbit Polyclonal Antibody
TA342645

USD 375.00

5 Days

Rabbit Polyclonal Anti-AVPR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AVPR2 antibody: synthetic peptide directed towards the C terminal of human AVPR2. Synthetic peptide located within the following region: NPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTS
AVPR V2 (AVPR2) Rabbit Polyclonal Antibody
TA321049

USD 345.00

In Stock

Anti-AVPR2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 359-371 amino acids of human arginine vasopressin receptor 2
AVPR V2 (AVPR2) Rabbit Polyclonal Antibody
TA373876

USD 220.00

3 Weeks

AVPR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 232-371 of human AVPR2 (NP_000045.1).
Modifications Unmodified