Antibodies

Jump to Filters
View as table Download
C20orf4 (AAR2) Rabbit Polyclonal Antibody
TA331950

USD 375.00

5 Days

Rabbit Polyclonal Anti-AAR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AAR2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AAR2. Synthetic peptide located within the following region: KFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWST
C20orf4 (AAR2) Rabbit Polyclonal Antibody
TA373113

USD 275.00

3 Weeks

AAR2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AAR2.