Antibodies

Jump to Filters
View as table Download
ABHD1 Rabbit Polyclonal Antibody
TA339617

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABHD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD1 antibody: synthetic peptide directed towards the middle region of human ABHD1. Synthetic peptide located within the following region: GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE
ABHD1 Rabbit Polyclonal Antibody
TA322133

USD 345.00

In Stock

Anti-ABHD1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human abhydrolase domain containing 1