Antibodies

View as table Download

Rabbit Polyclonal Anti-ABHD12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABHD12 Antibody: synthetic peptide directed towards the middle region of human ABHD12. Synthetic peptide located within the following region: CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH

Goat Anti-ABHD12 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-REFLGKSEPEHQH, from the C-Terminus of the protein sequence according to NP_001035937.1; NP_056415.1.

Rabbit anti-ABHD12 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABHD12.

Rabbit polyclonal anti-ABHD12 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABHD12.

Anti-ABHD12 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 96-398 amino acids of human abhydrolase domain containing 12

Anti-ABHD12 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 96-398 amino acids of human abhydrolase domain containing 12

Abhd12 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

ABHD12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human ABHD12 (NP_056415.1).
Modifications Unmodified