Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ABI2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABI2 antibody is: synthetic peptide directed towards the N-terminal region of Human ABI2. Synthetic peptide located within the following region: MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTT |
ABI2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ABI2 |
ABI2 rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABI2 |
ABI2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABI2 |
ABI2 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- ABI2