Antibodies

View as table Download

Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV

Rabbit polyclonal ACHE Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACHE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-175 amino acids from the N-terminal region of human ACHE.

Rabbit Polyclonal Anti-ACHE Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACHE antibody: synthetic peptide directed towards the middle region of human ACHE. Synthetic peptide located within the following region: VGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEA

Acetylcholinesterase (ACHE) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 560-600 of Human AChE.

Goat Polyclonal Antibody against ACHE

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QFDHYSKQDRCSDL, from the C Terminus of the protein sequence according to NP_000656.1.

Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 551 and 614 of AChE (Uniprot ID#P22303)

Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 406 and 614 of AChE (Uniprot ID#P22303)

Rabbit polyclonal ACHE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ACHE.

Mouse monoclonal anti-ACHE antibody (C-term)

Applications WB
Reactivities Human, Mouse, Rat (Predicted: Bovine, Rabbit)
Conjugation Unconjugated

Rabbit Polyclonal Anti-ACHE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACHE

ACHE Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified