Germany
Japan
United Kingdom
China
ATP citrate lyase (ACLY) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 430-480 of Human ATP-Citrate synthase. |
Antibodies
View as table Download
Rabbit Polyclonal anti-ACLY antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI |
Rabbit Polyclonal anti-ACLY antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA |
Carrier-free (BSA/glycerol-free) ACLY mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACLY Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACLY |
Rabbit Polyclonal Anti-ACLY Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACLY |
ACLY Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 752-1101 of human ACLY (NP_001087.2). |
| Modifications | Unmodified |
Phospho-ACLY-S455 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S455 of human ACLY (NP_001087.2). |
| Modifications | Phospho S455 |
ATP Citrate lyase Rabbit monoclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ACLY