Rabbit Polyclonal Anti-ACOXL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACOXL Antibody is: synthetic peptide directed towards the C-terminal region of Human ACOXL. Synthetic peptide located within the following region: AQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVK |
Rabbit Polyclonal Anti-ACOXL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACOXL Antibody is: synthetic peptide directed towards the C-terminal region of Human ACOXL. Synthetic peptide located within the following region: SRRQFGPKTKEEVKIIEHQTQTLRLMPHLATALALTFVSRYAGALLDEDV |
Germany
Japan
United Kingdom
China