Antibodies

Jump to Filters
View as table Download
ACSM4 Rabbit Polyclonal Antibody
TA332218

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACSM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACSM4 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACSM4. Synthetic peptide located within the following region: DQWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPC