Antibodies

Jump to Filters
View as table Download
ACTL7A (N-term) Rabbit Polyclonal Antibody
AP50069PU-N

USD 512.00

2 Weeks

ACTL7A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 48-75 amino acids from the N-terminal region of human ACTL7A
Actl7a Rabbit Polyclonal Antibody
TA335657

USD 375.00

5 Days

Rabbit Polyclonal Anti-Actl7a Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Actl7a Antibody is synthetic peptide directed towards the middle region of Mouse Actl7a. Synthetic peptide located within the following region: VVPIYEGYPLPSITGRLDYAGSDLTTYLMNLMNNSGKHFSEDHLGIVEDI
ACTL7A Rabbit Polyclonal Antibody
TA361710

USD 360.00

5 Days

ACTL7A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACTL7A