Antibodies

Jump to Filters
View as table Download
Arp2 (ACTR2) Rabbit Polyclonal Antibody
TA332871

USD 275.00

3 Weeks

Rabbit anti-ACTR2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTR2
Arp2 (ACTR2) Rabbit Polyclonal Antibody
TA338973

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-ACTR2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTR2 antibody: synthetic peptide directed towards the N terminal of human ACTR2. Synthetic peptide located within the following region: NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE
Arp2 (ACTR2) (40-311) Rabbit Polyclonal Antibody
AP23173PU-N

USD 440.00

2 Weeks

Arp2 (ACTR2) (40-311) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 40 and 311 of Human Arp2
Arp2 (ACTR2) Rabbit Polyclonal Antibody
TA338972

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACTR2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTR2 antibody: synthetic peptide directed towards the middle region of human ACTR2. Synthetic peptide located within the following region: RELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDK
Arp2 (ACTR2) Mouse Monoclonal Antibody [Clone ID: 149/1]
TA352944L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-ACTR2 Clone 149/1

Reactivities Human
Conjugation Unconjugated
Arp2 (ACTR2) Rabbit Polyclonal Antibody
TA349520

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACTR2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACTR2
ACTR2 Rabbit Polyclonal Antibody
TA364615

USD 380.00

4 Weeks

ACTR2 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACTR2