Antibodies

Jump to Filters
View as table Download
ADCY6 Rabbit Polyclonal Antibody
TA341966

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ADCY6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY
ADCY6 Rabbit Polyclonal Antibody
TA313425

USD 345.00

In Stock

Rabbit polyclonal anti-ADCY5/6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6.
ADCY6 Rabbit Polyclonal Antibody
TA310097

USD 230.00

3 Weeks

Rabbit anti-ADCY6 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH